IL1A antibody (N-Term)

Catalog No. ABIN634266

Product Details anti-IL1A Antibody

Target: IL1A (Interleukin 1 alpha (IL1A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL1 alpha antibody was raised against the N terminal of IL1 A

Purification: Affinity purified

Immunogen: IL1 alpha antibody was raised using the N terminal of IL1 A corresponding to a region with amino acids VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL1 alpha Blocking Peptide, catalog no. 33R-9834, is also available for use as a blocking control in assays to test for specificity of this IL1 alpha antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL1A

Target: IL1A (Interleukin 1 alpha (IL1A))

Alternative Name: IL1 alpha (IL1A Products)

Synonyms: IL-1A antibody, IL1 antibody, IL1-ALPHA antibody, IL1F1 antibody, IL-6 antibody, Il-1a antibody, IL-1 alpha antibody, IL-1alpha antibody, L1A antibody, interleukin 1 alpha antibody, interleukin 6 antibody, IL1A antibody, IL6 antibody, Il1a antibody

Background: The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, Autophagy, Cancer Immune Checkpoints