JAG2 antibody (N-Term)

Catalog No. ABIN634269

Product Details anti-JAG2 Antibody

Target: JAG2 (Jagged 2 (JAG2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JAG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Jagged 2 antibody was raised against the N terminal of JAG2

Purification: Affinity purified

Immunogen: Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Jagged 2 Blocking Peptide, catalog no. 33R-7820, is also available for use as a blocking control in assays to test for specificity of this Jagged 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for JAG2

Target: JAG2 (Jagged 2 (JAG2))

Alternative Name: Jagged 2 (JAG2 Products)

Synonyms: D12Ggc2e antibody, Serh antibody, mJagged2-1 antibody, sm antibody, HJ2 antibody, SER2 antibody, jag2 antibody, serB antibody, zgc:152855 antibody, jagged 2 antibody, jagged 2b antibody, JAG2 antibody, jag2 antibody, Jag2 antibody, jag2b antibody

Background: The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions.

Molecular Weight: 130 kDa (MW of target protein)

Pathways: Notch Signaling, Sensory Perception of Sound