ARAF antibody (Middle Region)

Catalog No. ABIN634291

Product Details anti-ARAF Antibody

Target: ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARAF antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARAF antibody was raised against the middle region of ARAF

Purification: Affinity purified

Immunogen: ARAF antibody was raised using the middle region of ARAF corresponding to a region with amino acids PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARAF Blocking Peptide, catalog no. 33R-7324, is also available for use as a blocking control in assays to test for specificity of this ARAF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARAF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARAF

Target: ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))

Alternative Name: ARAF (ARAF Products)

Synonyms: zgc:92074 antibody, wu:fk45h07 antibody, ARAF antibody, a-raf antibody, araf antibody, araf1 antibody, pks2 antibody, rafa1 antibody, A-RAF antibody, ARAF1 antibody, PKS2 antibody, RAFA1 antibody, 1200013E08Rik antibody, A-Raf antibody, AW495444 antibody, Araf1 antibody, A-Raf proto-oncogene, serine/threonine kinase antibody, A-Raf proto-oncogene, serine/threonine kinase L homeolog antibody, A-Raf proto-oncogene, serine/threonine kinase S homeolog antibody, Araf proto-oncogene, serine/threonine kinase antibody, araf antibody, ARAF antibody, araf.L antibody, araf.S antibody, Araf antibody

Background: ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: MAPK Signaling, RTK Signaling, Hepatitis C