C4BPA antibody (Middle Region)
-
- Target See all C4BPA Antibodies
- C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C4BPA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C4 BPA antibody was raised against the middle region of C4 PA
- Purification
- Affinity purified
- Immunogen
- C4 BPA antibody was raised using the middle region of C4 PA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
- Top Product
- Discover our top product C4BPA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C4BPA Blocking Peptide, catalog no. 33R-7781, is also available for use as a blocking control in assays to test for specificity of this C4BPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))
- Alternative Name
- C4BPA (C4BPA Products)
- Synonyms
- CRES antibody, c4bp antibody, C4BP antibody, PRP antibody, complement component 4 binding protein, alpha chain antibody, C4b-binding protein alpha chain antibody, complement component 4 binding protein alpha antibody, complement component 4 binding protein, alpha antibody, LOC419851 antibody, c4bp antibody, C4BPA antibody, C4bpa antibody
- Background
- C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- Complement System
-