NCF4 antibody (N-Term)
-
- Target See all NCF4 Antibodies
- NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NCF4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NCF4 antibody was raised against the N terminal of NCF4
- Purification
- Affinity purified
- Immunogen
- NCF4 antibody was raised using the N terminal of NCF4 corresponding to a region with amino acids SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE
- Top Product
- Discover our top product NCF4 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NCF4 Blocking Peptide, catalog no. 33R-8572, is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))
- Alternative Name
- NCF4 (NCF4 Products)
- Background
- NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.
- Molecular Weight
- 39 kDa (MW of target protein)
-