RGS19 antibody (N-Term)
-
- Target See all RGS19 Antibodies
- RGS19 (Regulator of G-Protein Signalling 19 (RGS19))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RGS19 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RGS19 antibody was raised against the N terminal of RGS19
- Purification
- Affinity purified
- Immunogen
- RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW
- Top Product
- Discover our top product RGS19 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RGS19 Blocking Peptide, catalog no. 33R-7391, is also available for use as a blocking control in assays to test for specificity of this RGS19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RGS19 (Regulator of G-Protein Signalling 19 (RGS19))
- Alternative Name
- RGS19 (RGS19 Products)
- Synonyms
- RGS19 antibody, GAIP antibody, RGSGAIP antibody, 2610042F04Rik antibody, AI324841 antibody, AW547781 antibody, Camki antibody, Gaip antibody, regulator of G protein signaling 19 antibody, regulator of G-protein signaling 19 antibody, RGS19 antibody, Rgs19 antibody
- Background
- G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-