CAMKII gamma antibody (N-Term)

Catalog No. ABIN634349

Product Details anti-CAMKII gamma Antibody

Target: CAMKII gamma (CAMK2G) (Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAMKII gamma antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CAMKII antibody was raised against the N terminal of CAMKK2

Purification: Affinity purified

Immunogen: CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAMKII Blocking Peptide, catalog no. 33R-3291, is also available for use as a blocking control in assays to test for specificity of this CAMKII antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMKK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAMKII gamma

Target: CAMKII gamma (CAMK2G) (Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G))

Alternative Name: CAMKII (CAMK2G Products)

Synonyms: CAMK antibody, CAMK-II antibody, CAMKG antibody, 5930429P18Rik antibody, Camkg antibody, calcium/calmodulin dependent protein kinase II gamma antibody, calcium/calmodulin-dependent protein kinase II gamma antibody, CAMK2G antibody, Camk2g antibody

Background: CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: WNT Signaling, Interferon-gamma Pathway, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of long-term Neuronal Synaptic Plasticity