MKNK2 antibody (N-Term)

Catalog No. ABIN634405

Product Details anti-MKNK2 Antibody

Target: MKNK2 (MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MKNK2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MKNK2 antibody was raised against the N terminal of MKNK2

Purification: Affinity purified

Immunogen: MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MKNK2 Blocking Peptide, catalog no. 33R-8351, is also available for use as a blocking control in assays to test for specificity of this MKNK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKNK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MKNK2

Target: MKNK2 (MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2))

Alternative Name: MKNK2 (MKNK2 Products)

Synonyms: GPRK7 antibody, MNK2 antibody, gprk7 antibody, mnk2 antibody, 2010016G11Rik antibody, Gprk7 antibody, Mnk2 antibody, mknk2 antibody, wu:fb37e05 antibody, wz5090 antibody, fi34c11 antibody, wu:fi34c11 antibody, wu:fi41e12 antibody, zgc:55587 antibody, MAP kinase interacting serine/threonine kinase 2 antibody, MAP kinase-interacting serine/threonine kinase 2 antibody, MAP kinase interacting serine/threonine kinase 2b antibody, MAP kinase interacting serine/threonine kinase 2 L homeolog antibody, MAP kinase interacting serine/threonine kinase 2a antibody, MKNK2 antibody, mknk2 antibody, Mknk2 antibody, mknk2b antibody, mknk2.L antibody, mknk2a antibody

Background: MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: MAPK Signaling