PKC gamma antibody (Middle Region)
-
- Target See all PKC gamma (PRKCG) Antibodies
- PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PKC gamma antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKCG antibody was raised against the middle region of PRKCG
- Purification
- Affinity purified
- Immunogen
- PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG
- Top Product
- Discover our top product PRKCG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKCG Blocking Peptide, catalog no. 33R-10011, is also available for use as a blocking control in assays to test for specificity of this PRKCG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))
- Alternative Name
- PRKCG (PRKCG Products)
- Synonyms
- PRKCG antibody, PKC-gamma antibody, PKCC antibody, PKCG antibody, SCA14 antibody, PKCgamma antibody, Pkcc antibody, Prkcc antibody, PKC antibody, PKCI antibody, Prkc antibody, RATPKCI antibody, protein kinase C gamma antibody, protein kinase C, gamma antibody, protein kinase C gamma type antibody, PRKCG antibody, Prkcg antibody, LOC484316 antibody
- Background
- Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
- Molecular Weight
- 78 kDa (MW of target protein)
- Pathways
- WNT Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, G-protein mediated Events, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGF Signaling
-