GZMA antibody

Catalog No. ABIN634499

Product Details anti-GZMA Antibody

Target: GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GZMA antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Granzyme A Blocking Peptide, catalog no. 33R-9256, is also available for use as a blocking control in assays to test for specificity of this Granzyme A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GZMA

Target: GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA))

Alternative Name: Granzyme A (GZMA Products)

Synonyms: gzmA antibody, GZMA antibody, AW494114 antibody, Ctla-3 antibody, Ctla3 antibody, Hf antibody, SE1 antibody, TSP-1 antibody, TSP1 antibody, CTLA3 antibody, HFSP antibody, granzyme A antibody, Granzyme A antibody, granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) antibody, gzmA antibody, GZMA antibody, graa antibody, Gzma antibody

Background: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Apoptosis