Angiotensin II Type-1 Receptor antibody (N-Term)
-
- Target See all Angiotensin II Type-1 Receptor (AGTR1) Antibodies
- Angiotensin II Type-1 Receptor (AGTR1) (Angiotensin II Receptor, Type 1 (AGTR1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Angiotensin II Type-1 Receptor antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AGTR1 antibody was raised against the N terminal of AGTR1
- Purification
- Affinity purified
- Immunogen
- AGTR1 antibody was raised using the N terminal of AGTR1 corresponding to a region with amino acids ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI
- Top Product
- Discover our top product AGTR1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AGTR1 Blocking Peptide, catalog no. 33R-4056, is also available for use as a blocking control in assays to test for specificity of this AGTR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGTR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Angiotensin II Type-1 Receptor (AGTR1) (Angiotensin II Receptor, Type 1 (AGTR1))
- Alternative Name
- AGTR1 (AGTR1 Products)
- Synonyms
- AG2S antibody, AGTR1A antibody, AGTR1B antibody, AT1 antibody, AT1AR antibody, AT1B antibody, AT1BR antibody, AT1R antibody, AT2R1 antibody, AT2R1A antibody, AT2R1B antibody, HAT1R antibody, 1810074K20Rik antibody, AI551199 antibody, AT1a antibody, Agtr-1a antibody, Agtr1 antibody, Angtr-1a antibody, AT1A antibody, XAT-1 antibody, agtr1-A antibody, agtr1.2 antibody, AT1-R antibody, at1 antibody, AGTR1 antibody, Agtr-1b antibody, Angtr-1b antibody, agtr1 antibody, agtr1-a antibody, agtr1-b antibody, xAT antibody, angiotensin II receptor type 1 antibody, angiotensin II receptor, type 1a antibody, angiotensin II receptor type 1 S homeolog antibody, uncharacterized AGTR1 antibody, angiotensin II receptor, type 1b antibody, angiotensin II receptor type 1 L homeolog antibody, AGTR1 antibody, Agtr1a antibody, agtr1.S antibody, Agtr1 antibody, Agtr1b antibody, agtr1.L antibody
- Background
- Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. AGTR1 is the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, ACE Inhibitor Pathway, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour
-