TLR9 antibody (N-Term)

Catalog No. ABIN634525

Product Details anti-TLR9 Antibody

Target: TLR9 (Toll-Like Receptor 9 (TLR9))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TLR9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TLR9 antibody was raised against the N terminal of TLR9

Purification: Affinity purified

Immunogen: TLR9 antibody was raised using the N terminal of TLR9 corresponding to a region with amino acids VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TLR9 Blocking Peptide, catalog no. 33R-9556, is also available for use as a blocking control in assays to test for specificity of this TLR9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TLR9

Target: TLR9 (Toll-Like Receptor 9 (TLR9))

Alternative Name: TLR9 (TLR9 Products)

Synonyms: CD289 antibody, toll like receptor 9 antibody, toll-like receptor 9 antibody, TLR9 antibody, Tlr9 antibody

Background: TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Molecular Weight: 113 kDa (MW of target protein)

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades