TAPBP antibody
-
- Target See all TAPBP Antibodies
- TAPBP (TAP Binding Protein (Tapasin) (TAPBP))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TAPBP antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
- Top Product
- Discover our top product TAPBP Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TAPBP Blocking Peptide, catalog no. 33R-3219, is also available for use as a blocking control in assays to test for specificity of this TAPBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAPBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TAPBP (TAP Binding Protein (Tapasin) (TAPBP))
- Alternative Name
- TAPBP (TAPBP Products)
- Synonyms
- SI:dZ179B20.1 antibody, SI:dZ179B20.3 antibody, SI:dZ179B20.7 antibody, mhc1uda antibody, mhc1ufa antibody, tpsn antibody, zgc:109814 antibody, tapbp antibody, TAPBP antibody, D17Wsu91e antibody, TPN antibody, NGS17 antibody, TAPA antibody, TPSN antibody, TAP binding protein (tapasin), tandem duplicate 1 antibody, TAP binding protein antibody, tapbp.1 antibody, tapbp antibody, TAPBP antibody, Tapbp antibody
- Background
- TAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.
- Molecular Weight
- 46 kDa (MW of target protein)
-