SGK1 antibody (N-Term)

Catalog No. ABIN634587

Product Details anti-SGK1 Antibody

Target: SGK1 (serum/glucocorticoid Regulated Kinase 1 (SGK1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SGK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SGK1 antibody was raised against the N terminal of SGK1

Purification: Affinity purified

Immunogen: SGK1 antibody was raised using the N terminal of SGK1 corresponding to a region with amino acids ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SGK1 Blocking Peptide, catalog no. 33R-1406, is also available for use as a blocking control in assays to test for specificity of this SGK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SGK1

Target: SGK1 (serum/glucocorticoid Regulated Kinase 1 (SGK1))

Alternative Name: SGK1 (SGK1 Products)

Synonyms: SGK antibody, Sgk antibody, sgk-B antibody, sgk2 antibody, cb1083 antibody, sgk antibody, wu:fc20a09 antibody, sgk-A antibody, sgk1 antibody, sgk1-a antibody, sgk1-b antibody, serum/glucocorticoid regulated kinase 1 antibody, Serine/threonine-protein kinase sgk-1 antibody, serum/glucocorticoid regulated kinase 1 S homeolog antibody, serum/glucocorticoid regulated kinase 1 L homeolog antibody, SGK1 antibody, Sgk1 antibody, sgk-1 antibody, sgk1.S antibody, sgk1 antibody, sgk1.L antibody

Background: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: MAPK Signaling, Notch Signaling, Steroid Hormone Mediated Signaling Pathway