SPON2 antibody (N-Term)

Catalog No. ABIN634656

Product Details anti-SPON2 Antibody

Target: SPON2 (Spondin 2 (SPON2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPON2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPON2 antibody was raised against the N terminal of SPON2

Purification: Affinity purified

Immunogen: SPON2 antibody was raised using the N terminal of SPON2 corresponding to a region with amino acids CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPON2 Blocking Peptide, catalog no. 33R-1803, is also available for use as a blocking control in assays to test for specificity of this SPON2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPON2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPON2

Target: SPON2 (Spondin 2 (SPON2))

Alternative Name: SPON2 (SPON2 Products)

Synonyms: DIL-1 antibody, DIL1 antibody, M-SPONDIN antibody, MINDIN antibody, 2310045I24Rik antibody, AI504350 antibody, M-spondin antibody, Mindin antibody, Mspondin antibody, etID309958.14 antibody, mindin2 antibody, zgc:100756 antibody, mindin1 antibody, spondin 2 antibody, spondin 2, extracellular matrix protein antibody, spondin 2, extracellular matrix protein S homeolog antibody, spondin 2b, extracellular matrix protein antibody, spondin 2a, extracellular matrix protein antibody, SPON2 antibody, Spon2 antibody, spon2.S antibody, spon2b antibody, spon2a antibody

Background: SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.

Molecular Weight: 36 kDa (MW of target protein)