TDO2 antibody (N-Term)
-
- Target See all TDO2 Antibodies
- TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TDO2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TDO2 antibody was raised against the N terminal of TDO2
- Purification
- Affinity purified
- Immunogen
- TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK
- Top Product
- Discover our top product TDO2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TDO2 Blocking Peptide, catalog no. 33R-6423, is also available for use as a blocking control in assays to test for specificity of this TDO2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))
- Alternative Name
- TDO2 (TDO2 Products)
- Synonyms
- Tdo2 antibody, tdo2l antibody, fi30d08 antibody, zgc:63488 antibody, wu:fi30d08 antibody, TDO2 antibody, fb62b10 antibody, tdo2 antibody, wu:fb62b10 antibody, zgc:103693 antibody, DDBDRAFT_0190495 antibody, DDBDRAFT_0231363 antibody, DDB_0190495 antibody, DDB_0231363 antibody, TDO antibody, TO antibody, TPH2 antibody, TRPO antibody, AA407491 antibody, chky antibody, Tdo antibody, tryptophan 2,3-dioxygenase b antibody, tryptophan 2,3-dioxygenase antibody, tryptophan 2,3-dioxygenase a antibody, tryptophan 2,3-dioxygenase L homeolog antibody, tdo2b antibody, tdo2 antibody, TDO2 antibody, MADE_02822 antibody, CtCNB1_3657 antibody, tdo2a antibody, CNC04830 antibody, tdo antibody, Mrub_2119 antibody, Deipr_2235 antibody, Acav_1166 antibody, Mesop_4278 antibody, Tdo2 antibody, tdo2.L antibody
- Background
- Tryptophan 2,3-dioxygenase plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.
- Molecular Weight
- 48 kDa (MW of target protein)
-