Thrombopoietin antibody
-
- Target See all Thrombopoietin (THPO) Antibodies
- Thrombopoietin (THPO)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Thrombopoietin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
- Top Product
- Discover our top product THPO Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Thrombopoietin Blocking Peptide, catalog no. 33R-6770, is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THPO antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Thrombopoietin (THPO)
- Alternative Name
- Thrombopoietin (THPO Products)
- Synonyms
- MGDF antibody, MKCSF antibody, ML antibody, MPLLG antibody, THCYT1 antibody, TPO antibody, Mgdf antibody, Ml antibody, Mpllg antibody, Tpo antibody, Tpo1 antibody, Tpo2 antibody, Tpo3 antibody, Tpo4 antibody, tpo antibody, LOC100231762 antibody, thrombopoietin antibody, THPO antibody, Thpo antibody, thpo antibody
- Background
- Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Hormone Activity
-