IL-9 antibody (Middle Region)

Catalog No. ABIN634807

Product Details anti-IL-9 Antibody

Target: IL-9 (IL9) (Interleukin 9 (IL9))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL9 antibody was raised against the middle region of IL9

Purification: Affinity purified

Immunogen: IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL9 Blocking Peptide, catalog no. 33R-8718, is also available for use as a blocking control in assays to test for specificity of this IL9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-9

Target: IL-9 (IL9) (Interleukin 9 (IL9))

Alternative Name: IL9 (IL9 Products)

Synonyms: IL9 antibody, IL-9 antibody, Il-9 antibody, P40 antibody, HP40 antibody, interleukin 9 antibody, IL9 antibody, il9 antibody, Il9 antibody

Background: IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: JAK-STAT Signaling