M-CSF/CSF1 antibody
-
- Target See all M-CSF/CSF1 (CSF1) Antibodies
- M-CSF/CSF1 (CSF1) (Colony Stimulating Factor 1 (Macrophage) (CSF1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This M-CSF/CSF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
- Top Product
- Discover our top product CSF1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CSF1 Blocking Peptide, catalog no. 33R-7283, is also available for use as a blocking control in assays to test for specificity of this CSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- M-CSF/CSF1 (CSF1) (Colony Stimulating Factor 1 (Macrophage) (CSF1))
- Alternative Name
- CSF1 (CSF1 Products)
- Synonyms
- CSF-1 antibody, MCSF antibody, C87615 antibody, Csfm antibody, op antibody, csf1-1 antibody, zgc:172186 antibody, CSF1 antibody, csf1-2 antibody, zgc:158436 antibody, colony stimulating factor 1 antibody, colony stimulating factor 1 (macrophage) antibody, colony stimulating factor 1a (macrophage) antibody, macrophage colony-stimulating factor 1 antibody, macrophage colony stimulating factor antibody, colony stimulating factor 1b (macrophage) antibody, CSF1 antibody, Csf1 antibody, csf1a antibody, LOC396599 antibody, LOC100860895 antibody, csf1b antibody
- Background
- CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- RTK Signaling
-