ATP2A1/SERCA1 antibody (N-Term)

Catalog No. ABIN634834

Product Details anti-ATP2A1/SERCA1 Antibody

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP2A1/SERCA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATP2 A1 antibody was raised against the N terminal of ATP2 1

Purification: Affinity purified

Immunogen: ATP2 A1 antibody was raised using the N terminal of ATP2 1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP2A1 Blocking Peptide, catalog no. 33R-5884, is also available for use as a blocking control in assays to test for specificity of this ATP2A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP2A1/SERCA1

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Alternative Name: ATP2A1 (ATP2A1 Products)

Synonyms: cb279 antibody, serca antibody, serca1 antibody, wu:cegs655 antibody, wu:fb17h11 antibody, wu:fb19b10 antibody, zgc:92110 antibody, ATP2A1 antibody, atp2a antibody, atp2a2 antibody, atp2b antibody, ca-p60a antibody, dar antibody, serca2 antibody, SERCA1 antibody, ATP2A3 antibody, SERCA1a antibody, Serca1 antibody, ATP2A antibody, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog antibody, atp2a1 antibody, ATP2A1 antibody, atp2a2.S antibody, Atp2a1 antibody

Background: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells.

Molecular Weight: 109 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process