Presenilin 1 antibody (N-Term)

Catalog No. ABIN634837

Product Details anti-Presenilin 1 Antibody

Target: Presenilin 1 (PSEN1)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Presenilin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Presenilin 1 antibody was raised against the N terminal of PSEN1

Purification: Affinity purified

Immunogen: Presenilin 1 antibody was raised using the N terminal of PSEN1 corresponding to a region with amino acids TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Presenilin 1 Blocking Peptide, catalog no. 33R-9260, is also available for use as a blocking control in assays to test for specificity of this Presenilin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSEN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Presenilin 1

Target: Presenilin 1 (PSEN1)

Alternative Name: Presenilin 1 (PSEN1 Products)

Synonyms: pre1 antibody, psen antibody, zfPS1 antibody, zf-PS1 antibody, ad3 antibody, fad antibody, ps1 antibody, s182 antibody, X-PS-beta antibody, X-PS-alpha antibody, AD3 antibody, FAD antibody, PS-1 antibody, PS1 antibody, S182 antibody, Ad3h antibody, presenilin 1 antibody, presenilin 1 L homeolog antibody, psen1 antibody, PSEN1 antibody, Psen1 antibody, psen1.L antibody

Background: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1, PSEN2) or in the amyloid precursor protein (APP).

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Notch Signaling, EGFR Signaling Pathway, Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport