GGCX antibody (Middle Region)
-
- Target See all GGCX Antibodies
- GGCX (gamma-Glutamyl Carboxylase (GGCX))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GGCX antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GGCX antibody was raised against the middle region of GGCX
- Purification
- Affinity purified
- Immunogen
- GGCX antibody was raised using the middle region of GGCX corresponding to a region with amino acids FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE
- Top Product
- Discover our top product GGCX Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GGCX Blocking Peptide, catalog no. 33R-2973, is also available for use as a blocking control in assays to test for specificity of this GGCX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGCX antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGCX (gamma-Glutamyl Carboxylase (GGCX))
- Alternative Name
- GGCX (GGCX Products)
- Synonyms
- GGCX antibody, cb751 antibody, si:ch1073-230p18.3 antibody, zgc:158736 antibody, ggcx antibody, GGC antibody, vkcfd1 antibody, CG13927 antibody, DgammaC antibody, Dmel\\CG13927 antibody, dGC antibody, dgammaC antibody, gammaC antibody, VKCFD1 antibody, gamma-glutamyl carboxylase antibody, gamma-glutamyl carboxylase L homeolog antibody, GGCX antibody, ggcx antibody, GC antibody, sce5891 antibody, ggcx.L antibody, Ggcx antibody
- Background
- GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.
- Molecular Weight
- 87 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-