KCC2 antibody
-
- Target See all KCC2 (SLC12A5) Antibodies
- KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC12 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG
- Top Product
- Discover our top product SLC12A5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC12A5 Blocking Peptide, catalog no. 33R-9750, is also available for use as a blocking control in assays to test for specificity of this SLC12A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))
- Alternative Name
- SLC12A5 (SLC12A5 Products)
- Synonyms
- Kcc2 antibody, KCC2 antibody, mKIAA1176 antibody, solute carrier family 12 member 5 antibody, solute carrier family 12, member 5 antibody, SLC12A5 antibody, Slc12a5 antibody
- Background
- K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential.
- Molecular Weight
- 123 kDa (MW of target protein)
-