Tmc2 antibody (Middle Region)

Catalog No. ABIN634892

Product Details anti-Tmc2 Antibody

Target: Tmc2 (Transmembrane Channel-Like 2 (Tmc2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tmc2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMC2 antibody was raised against the middle region of TMC2

Purification: Affinity purified

Immunogen: TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMC2 Blocking Peptide, catalog no. 33R-10062, is also available for use as a blocking control in assays to test for specificity of this TMC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tmc2

Target: Tmc2 (Transmembrane Channel-Like 2 (Tmc2))

Alternative Name: TMC2 (Tmc2 Products)

Synonyms: C20orf145 antibody, dJ686C3.3 antibody, CWEA2 antibody, transmembrane channel like 2 antibody, transmembrane channel-like 2 antibody, transmembrane channel-like gene family 2 antibody, TMC2 antibody, Tmc2 antibody

Background: TMC2 is considered a member of transmembrane proteins family. The specific function of this gene is unknown, however, expression in the inner ear suggests that it may be crucial for normal auditory function. This gene is considered a member of a gene family predicted to encode transmembrane proteins.

Molecular Weight: 102 kDa (MW of target protein)