DPP6 antibody (Middle Region)
-
- Target See all DPP6 Antibodies
- DPP6 (Dipeptidyl-Peptidase 6 (DPP6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPP6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DPP6 antibody was raised against the middle region of DPP6
- Purification
- Affinity purified
- Immunogen
- DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ
- Top Product
- Discover our top product DPP6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DPP6 Blocking Peptide, catalog no. 33R-2964, is also available for use as a blocking control in assays to test for specificity of this DPP6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPP6 (Dipeptidyl-Peptidase 6 (DPP6))
- Alternative Name
- DPP6 (DPP6 Products)
- Synonyms
- dppx antibody, DPPX antibody, VF2 antibody, DPP VI antibody, dpp6 antibody, si:ch211-198f16.1 antibody, B930011P16Rik antibody, D5Buc3 antibody, D5Buc4 antibody, D5Buc5 antibody, Dpp-6 antibody, Gm1377 antibody, In(5)6H-p antibody, Peplb antibody, Rw antibody, dipeptidyl peptidase like 6 antibody, dipeptidyl-peptidase 6 antibody, dipeptidyl-peptidase 6b antibody, dipeptidylpeptidase 6 antibody, DPP6 antibody, dpp6 antibody, BCAN_A2221 antibody, BSUIS_A2016 antibody, Bsph_2289 antibody, BMEA_A2239 antibody, dpp6b antibody, Dpp6 antibody
- Background
- DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.
- Molecular Weight
- 91 kDa (MW of target protein)
-