PARL antibody (N-Term)

Catalog No. ABIN634971

Product Details anti-PARL Antibody

Target: PARL (Presenilin Associated, Rhomboid-Like (PARL))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PARL antibody was raised against the N terminal of PARL

Purification: Affinity purified

Immunogen: PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARL Blocking Peptide, catalog no. 33R-8594, is also available for use as a blocking control in assays to test for specificity of this PARL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARL

Target: PARL (Presenilin Associated, Rhomboid-Like (PARL))

Alternative Name: PARL (PARL Products)

Synonyms: PSARL antibody, PSARL1 antibody, PSENIP2 antibody, RHBDS1 antibody, D16Ertd607e antibody, PRO2207 antibody, Psarl antibody, parl antibody, zgc:112986 antibody, presenilin associated rhomboid like antibody, presenilin associated, rhomboid-like antibody, presenilin associated, rhomboid-like a antibody, PARL antibody, Parl antibody, parla antibody

Background: PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Autophagy