SPPL2B antibody (N-Term)

Catalog No. ABIN634985

Product Details anti-SPPL2B Antibody

Target: SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPPL2B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SPPL2 B antibody was raised against the N terminal of SPPL2

Purification: Affinity purified

Immunogen: SPPL2 B antibody was raised using the N terminal of SPPL2 corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPPL2B Blocking Peptide, catalog no. 33R-9434, is also available for use as a blocking control in assays to test for specificity of this SPPL2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPPL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPPL2B

Target: SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))

Alternative Name: SPPL2B (SPPL2B Products)

Synonyms: SPPL2B antibody, wu:fc16e01 antibody, wu:fc85d12 antibody, zgc:136525 antibody, MGC147524 antibody, IMP-4 antibody, IMP4 antibody, PSH4 antibody, PSL1 antibody, 3110056O03Rik antibody, AW550292 antibody, RGD1308556 antibody, signal peptide peptidase-like 2 antibody, signal peptide peptidase like 2B antibody, signal peptide peptidase like 2B S homeolog antibody, signal peptide peptidase-like 2B antibody, sppl2 antibody, sppl2b antibody, sppl2b.S antibody, SPPL2B antibody, Sppl2b antibody

Background: SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

Molecular Weight: 56 kDa (MW of target protein)