COX18 antibody
-
- Target See all COX18 Antibodies
- COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This COX18 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR
- Top Product
- Discover our top product COX18 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
COX18 Blocking Peptide, catalog no. 33R-4833, is also available for use as a blocking control in assays to test for specificity of this COX18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))
- Alternative Name
- COX18 (COX18 Products)
- Synonyms
- COX18HS antibody, BC038311 antibody, RGD1559547 antibody, COX18 cytochrome c oxidase assembly factor L homeolog antibody, COX18, cytochrome c oxidase assembly factor antibody, cytochrome c oxidase assembly protein 18 antibody, cox18.L antibody, COX18 antibody, Cox18 antibody
- Background
- COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.
- Molecular Weight
- 37 kDa (MW of target protein)
-