RNF185 antibody (Middle Region)
-
- Target See all RNF185 Antibodies
- RNF185 (Ring Finger Protein 185 (RNF185))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF185 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF185 antibody was raised against the middle region of RNF185
- Purification
- Affinity purified
- Immunogen
- RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF
- Top Product
- Discover our top product RNF185 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF185 Blocking Peptide, catalog no. 33R-7767, is also available for use as a blocking control in assays to test for specificity of this RNF185 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF185 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF185 (Ring Finger Protein 185 (RNF185))
- Alternative Name
- RNF185 (RNF185 Products)
- Synonyms
- zgc:73070 antibody, xrnf185 antibody, 1700022N24Rik antibody, AL033296 antibody, ring finger protein 185 antibody, ring finger protein 185 L homeolog antibody, rnf185 antibody, rnf185.L antibody, RNF185 antibody, Rnf185 antibody
- Background
- The exact function of RNF185 remains unknown.
- Molecular Weight
- 20 kDa (MW of target protein)
-