Slc30a3 antibody
-
- Target See all Slc30a3 Antibodies
- Slc30a3 (Solute Carrier Family 30 (Zinc Transporter), Member 3 (Slc30a3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Slc30a3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC30 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG
- Top Product
- Discover our top product Slc30a3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC30A3 Blocking Peptide, catalog no. 33R-1388, is also available for use as a blocking control in assays to test for specificity of this SLC30A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc30a3 (Solute Carrier Family 30 (Zinc Transporter), Member 3 (Slc30a3))
- Alternative Name
- SLC30A3 (Slc30a3 Products)
- Synonyms
- pp12488 antibody, slc30a3 antibody, znt-2 antibody, znt2 antibody, ZnT3 antibody, ZNT3 antibody, Znt3 antibody, T32F6.21 antibody, T32F6_21 antibody, zinc transporter 3 precursor antibody, solute carrier family 30 member 2 antibody, solute carrier family 30 member 3 antibody, solute carrier family 30 (zinc transporter), member 3 antibody, zinc transporter 3 precursor antibody, slc30a2 antibody, SLC30A3 antibody, Slc30a3 antibody, ZIP3 antibody
- Background
- SLC30A3 is involved in accumulation of zinc in synaptic vesicles.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-