TTYH1 antibody
-
- Target See all TTYH1 Antibodies
- TTYH1 (Tweety Homolog 1 (TTYH1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TTYH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TTYH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA
- Top Product
- Discover our top product TTYH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TTYH1 Blocking Peptide, catalog no. 33R-3168, is also available for use as a blocking control in assays to test for specificity of this TTYH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTYH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTYH1 (Tweety Homolog 1 (TTYH1))
- Alternative Name
- TTYH1 (TTYH1 Products)
- Synonyms
- 4930459B04Rik antibody, 6330408P11Rik antibody, tty antibody, TTYH1 antibody, ttyh1-A antibody, tweety family member 1 antibody, tweety family member 1 L homeolog antibody, Protein tweety homolog 1 antibody, Ttyh1 antibody, TTYH1 antibody, ttyh1.L antibody, ttyh-1 antibody
- Background
- TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Molecular Weight
- 49 kDa (MW of target protein)
-