SPNS1/Spinster 1 antibody
-
- Target See all SPNS1/Spinster 1 (SPNS1) Antibodies
- SPNS1/Spinster 1 (SPNS1) (Spinster Homolog 1 (SPNS1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPNS1/Spinster 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SPNS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT
- Top Product
- Discover our top product SPNS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPNS1 Blocking Peptide, catalog no. 33R-1219, is also available for use as a blocking control in assays to test for specificity of this SPNS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPNS1/Spinster 1 (SPNS1) (Spinster Homolog 1 (SPNS1))
- Alternative Name
- SPNS1 (SPNS1 Products)
- Synonyms
- etID64740.3 antibody, nrs antibody, spinl antibody, wu:fb95b12 antibody, wu:fi37e11 antibody, 2210013K02Rik antibody, Spin1 antibody, Spinl antibody, HSpin1 antibody, LAT antibody, PP2030 antibody, SPIN1 antibody, SPINL antibody, spinster antibody, RGD1305613 antibody, sphingolipid transporter 1 (putative) antibody, spinster homolog 1 (Drosophila) antibody, spinster homolog 1 antibody, spinster homolog 1 L homeolog antibody, sphingolipid transporter 1 antibody, SPNS1 antibody, spns1 antibody, Spns1 antibody, spns1.L antibody
- Background
- SPNS1 is the Sphingolipid transporter. It may be involved in necrotic or autophagic cell death. It belongs to the major facilitator superfamily, spinster family.
- Molecular Weight
- 56 kDa (MW of target protein)
-