ORAI2 antibody (Middle Region)
-
- Target See all ORAI2 Antibodies
- ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ORAI2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ORAI2 antibody was raised against the middle region of ORAI2
- Purification
- Affinity purified
- Immunogen
- ORAI2 antibody was raised using the middle region of ORAI2 corresponding to a region with amino acids IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ
- Top Product
- Discover our top product ORAI2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ORAI2 Blocking Peptide, catalog no. 33R-3944, is also available for use as a blocking control in assays to test for specificity of this ORAI2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))
- Alternative Name
- ORAI2 (ORAI2 Products)
- Synonyms
- C7orf19 antibody, CBCIP2 antibody, MEM142B antibody, TMEM142B antibody, A730041O15Rik antibody, Tmem142b antibody, RGD1310213 antibody, ORAI2 antibody, orai-1 antibody, orai1 antibody, tmem142a antibody, tmem142b antibody, LOC100230993 antibody, ORAI calcium release-activated calcium modulator 2 antibody, ORAI calcium release-activated calcium modulator 2 S homeolog antibody, ORAI2 antibody, Orai2 antibody, orai2.S antibody, orai2 antibody
- Background
- ORAI2 is a multi-pass membrane protein, and it belongs to the Orai family. It is a Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.
- Molecular Weight
- 28 kDa (MW of target protein)
-