Sphingomyelin Synthase 1 antibody (Middle Region)
-
- Target See all Sphingomyelin Synthase 1 (SGMS1) Antibodies
- Sphingomyelin Synthase 1 (SGMS1)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Sphingomyelin Synthase 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SGMS1 antibody was raised against the middle region of SGMS1
- Purification
- Affinity purified
- Immunogen
- SGMS1 antibody was raised using the middle region of SGMS1 corresponding to a region with amino acids SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI
- Top Product
- Discover our top product SGMS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SGMS1 Blocking Peptide, catalog no. 33R-8327, is also available for use as a blocking control in assays to test for specificity of this SGMS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Sphingomyelin Synthase 1 (SGMS1)
- Alternative Name
- SGMS1 (SGMS1 Products)
- Synonyms
- MGC81436 antibody, TMEM23 antibody, MOB antibody, MOB1 antibody, SMS1 antibody, hmob33 antibody, 9530058O11Rik antibody, AI841905 antibody, C80702 antibody, Mob antibody, Sms1 antibody, Sor1 antibody, Tmem23 antibody, sphingomyelin synthase 1 antibody, sphingomyelin synthase 1 S homeolog antibody, phosphatidylcholine:ceramide cholinephosphotransferase 1 antibody, SGMS1 antibody, sgms1.S antibody, LOC100013212 antibody, Sgms1 antibody
- Background
- SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin
-