SLC10A1 antibody
-
- Target See all SLC10A1 Antibodies
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC10A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC10 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY
- Top Product
- Discover our top product SLC10A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC10A1 Blocking Peptide, catalog no. 33R-9542, is also available for use as a blocking control in assays to test for specificity of this SLC10A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
- Alternative Name
- SLC10A1 (SLC10A1 Products)
- Synonyms
- Ntcp antibody, NTCP antibody, Ntcp1 antibody, SBACT antibody, solute carrier family 10 (sodium/bile acid cotransporter family), member 1 antibody, solute carrier family 10 member 1 antibody, Slc10a1 antibody, SLC10A1 antibody
- Background
- Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids.
- Molecular Weight
- 38 kDa (MW of target protein)
-