GPR161 antibody (Middle Region)
-
- Target See all GPR161 Antibodies
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPR161 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- GPR161 antibody was raised against the middle region of GPR161
- Purification
- Affinity purified
- Immunogen
- GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG
- Top Product
- Discover our top product GPR161 Primary Antibody
-
-
- Application Notes
-
WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPR161 Blocking Peptide, catalog no. 33R-2995, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
- Alternative Name
- GPR161 (GPR161 Products)
- Synonyms
- RE2 antibody, Gm208 antibody, Gm208Gpr antibody, vl antibody, RGD1563245 antibody, si:bz20i5.4 antibody, si:rp71-20i5.4 antibody, G protein-coupled receptor 161 antibody, GPR161 antibody, Gpr161 antibody, gpr161 antibody
- Background
- GPR161 is Orphan receptor.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-