DLL3 antibody
-
- Target See all DLL3 Antibodies
- DLL3 (delta Like Protein 3 (DLL3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC
- Top Product
- Discover our top product DLL3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLL3 Blocking Peptide, catalog no. 33R-6609, is also available for use as a blocking control in assays to test for specificity of this DLL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLL3 (delta Like Protein 3 (DLL3))
- Alternative Name
- DLL3 (DLL3 Products)
- Synonyms
- SCDO1 antibody, pu antibody, pudgy antibody, delta like canonical Notch ligand 3 antibody, delta-like 3 (Drosophila) antibody, DLL3 antibody, Dll3 antibody
- Background
- DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1.
- Molecular Weight
- 54 kDa (MW of target protein)
- Pathways
- Notch Signaling
-