COMT antibody (Middle Region)
-
- Target See all COMT Antibodies
- COMT (Catechol-O-Methyltransferase (COMT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This COMT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- COMT antibody was raised against the middle region of COMT
- Purification
- Affinity purified
- Immunogen
- COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
- Top Product
- Discover our top product COMT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
COMT Blocking Peptide, catalog no. 33R-7005, is also available for use as a blocking control in assays to test for specificity of this COMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COMT (Catechol-O-Methyltransferase (COMT))
- Alternative Name
- COMT (COMT Products)
- Synonyms
- Comt1 antibody, D16Wsu103e antibody, D330014B15Rik antibody, COMT antibody, mb-comt antibody, s-comt antibody, comt antibody, MGC154444 antibody, zgc:114157 antibody, si:dkey-13a21.15 antibody, zK13A21.15 antibody, zgc:162236 antibody, catechol-O-methyltransferase antibody, microRNA 4761 antibody, catechol-O-methyltransferase S homeolog antibody, methyltransferase antibody, catechol-o-methyltransferase antibody, catechol-O-methyltransferase a antibody, catechol-O-methyltransferase b antibody, catechol O-methyltransferase antibody, COMT antibody, Comt antibody, MIR4761 antibody, comt antibody, comt.2 antibody, comt.S antibody, Rv1703c antibody, Mb1729c antibody, comta antibody, comtb antibody, LOC100354142 antibody
- Background
- Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine.
- Molecular Weight
- 30 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, SARS-CoV-2 Protein Interactome
-