SLC39A5 antibody
-
- Target See all SLC39A5 Antibodies
- SLC39A5 (Solute Carrier Family 39 (Metal Ion Transporter), Member 5 (SLC39A5))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC39A5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC39 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS
- Top Product
- Discover our top product SLC39A5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC39A5 Blocking Peptide, catalog no. 33R-3877, is also available for use as a blocking control in assays to test for specificity of this SLC39A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A5 (Solute Carrier Family 39 (Metal Ion Transporter), Member 5 (SLC39A5))
- Alternative Name
- SLC39A5 (SLC39A5 Products)
- Synonyms
- 1810013D05Rik antibody, 2010205A06Rik antibody, Zip5 antibody, LZT-Hs7 antibody, ZIP5 antibody, solute carrier family 39 member 5 antibody, solute carrier family 39 (metal ion transporter), member 5 antibody, SLC39A5 antibody, Slc39a5 antibody
- Background
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-