FCRLA antibody (Middle Region)
-
- Target See all FCRLA Antibodies
- FCRLA (Fc Receptor-Like A (FCRLA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FCRLA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FCRLA antibody was raised against the middle region of FCRLA
- Purification
- Affinity purified
- Immunogen
- FCRLA antibody was raised using the middle region of FCRLA corresponding to a region with amino acids PTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYH
- Top Product
- Discover our top product FCRLA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FCRLA Blocking Peptide, catalog no. 33R-7389, is also available for use as a blocking control in assays to test for specificity of this FCRLA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCRLA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FCRLA (Fc Receptor-Like A (FCRLA))
- Alternative Name
- FCRLA (FCRLA Products)
- Synonyms
- FCRL antibody, FCRL1 antibody, FCRLM1 antibody, FCRLX antibody, FCRLb antibody, FCRLc1 antibody, FCRLc2 antibody, FCRLd antibody, FCRLe antibody, FCRX antibody, FREB antibody, BB219290 antibody, Fcrlm1 antibody, Fcrx antibody, Freb1 antibody, mFREB antibody, mFcrX antibody, RGD1306176 antibody, Fc receptor like A antibody, Fc receptor-like A antibody, FCRLA antibody, Fcrla antibody
- Background
- Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.
- Molecular Weight
- 41 kDa (MW of target protein)
-