MMP16 antibody

Catalog No. ABIN635772

Product Details anti-MMP16 Antibody

Target: MMP16 (Matrix Metallopeptidase 16 (Membrane-inserted) (MMP16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP16 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MMP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP16 Blocking Peptide, catalog no. 33R-1318, is also available for use as a blocking control in assays to test for specificity of this MMP16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP16

Target: MMP16 (Matrix Metallopeptidase 16 (Membrane-inserted) (MMP16))

Alternative Name: MMP16 (MMP16 Products)

Synonyms: MT3-MMP antibody, Mt3mmp antibody, Mt3-mmp antibody, C8orf57 antibody, MMP-X2 antibody, MT-MMP2 antibody, MT-MMP3 antibody, matrix metallopeptidase 16 antibody, Mmp16 antibody, MMP16 antibody

Background: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

Molecular Weight: 56 kDa (MW of target protein)