ADAM19 antibody
-
- Target See all ADAM19 (Adam19) Antibodies
- ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADAM19 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG
- Top Product
- Discover our top product Adam19 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADAM19 Blocking Peptide, catalog no. 33R-9408, is also available for use as a blocking control in assays to test for specificity of this ADAM19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))
- Alternative Name
- ADAM19 (Adam19 Products)
- Synonyms
- AL024287 antibody, M[b] antibody, Mltnb antibody, MADDAM antibody, MLTNB antibody, Sox30 antibody, fksg34 antibody, maddam antibody, mltnb antibody, a disintegrin and metallopeptidase domain 19 (meltrin beta) antibody, ADAM metallopeptidase domain 19 antibody, ADAM metallopeptidase domain 19 S homeolog antibody, Adam19 antibody, ADAM19 antibody, adam19.S antibody
- Background
- ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
- Molecular Weight
- 82 kDa (MW of target protein)
-