PPIB antibody
-
- Target See all PPIB Antibodies
- PPIB (Cyclophilin B (PPIB))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPIB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKG
- Top Product
- Discover our top product PPIB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPIB Blocking Peptide, catalog no. 33R-4476, is also available for use as a blocking control in assays to test for specificity of this PPIB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIB (Cyclophilin B (PPIB))
- Alternative Name
- PPIB (PPIB Products)
- Synonyms
- cypb antibody, scylp antibody, cyp-s1 antibody, PPIB antibody, Ppib antibody, ACYPI004891 antibody, AA408962 antibody, AA553318 antibody, AI844835 antibody, Cphn-2 antibody, Cphn2 antibody, CyP-20b antibody, CypB antibody, Scylp antibody, CYP-S1 antibody, CYPB antibody, OI9 antibody, SCYLP antibody, cb87 antibody, sb:cb87 antibody, wu:fa97f08 antibody, zgc:73214 antibody, zgc:86796 antibody, peptidylprolyl isomerase B antibody, peptidylprolyl isomerase B (cyclophilin B) antibody, peptidylprolyl isomerase B L homeolog antibody, ppib antibody, PPIB antibody, Ppib antibody, CC1G_03223 antibody, ppib.L antibody
- Background
- PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.
- Molecular Weight
- 21 kDa (MW of target protein)
-