IGLL1 antibody (N-Term)
-
- Target See all IGLL1 Antibodies
- IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGLL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIGO antibody was raised against the N terminal of PIGO
- Purification
- Affinity purified
- Immunogen
- PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS
- Top Product
- Discover our top product IGLL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIGO Blocking Peptide, catalog no. 33R-5039, is also available for use as a blocking control in assays to test for specificity of this PIGO antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGO antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))
- Alternative Name
- IGO (IGLL1 Products)
- Synonyms
- 14.1 antibody, AGM2 antibody, CD179b antibody, IGL1 antibody, IGL5 antibody, IGLJ14.1 antibody, IGLL antibody, IGO antibody, IGVPB antibody, VPREB2 antibody, IGLV antibody, IGLL1 antibody, MGC151892 antibody, Igll1 antibody, BB139905 antibody, Igl-5 antibody, Igll antibody, Lambda5 antibody, immunoglobulin lambda like polypeptide 1 antibody, immunoglobulin lambda-like polypeptide 1 antibody, IGLL1 antibody, Igll1 antibody
- Background
- PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.
- Molecular Weight
- 74 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-