IGLL1 antibody (N-Term)

Catalog No. ABIN635874

Product Details anti-IGLL1 Antibody

Target: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGLL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIGO antibody was raised against the N terminal of PIGO

Purification: Affinity purified

Immunogen: PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGO Blocking Peptide, catalog no. 33R-5039, is also available for use as a blocking control in assays to test for specificity of this PIGO antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGLL1

Target: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Alternative Name: IGO (IGLL1 Products)

Synonyms: 14.1 antibody, AGM2 antibody, CD179b antibody, IGL1 antibody, IGL5 antibody, IGLJ14.1 antibody, IGLL antibody, IGO antibody, IGVPB antibody, VPREB2 antibody, IGLV antibody, IGLL1 antibody, MGC151892 antibody, Igll1 antibody, BB139905 antibody, Igl-5 antibody, Igll antibody, Lambda5 antibody, immunoglobulin lambda like polypeptide 1 antibody, immunoglobulin lambda-like polypeptide 1 antibody, IGLL1 antibody, Igll1 antibody

Background: PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.

Molecular Weight: 74 kDa (MW of target protein)

Pathways: Regulation of Cell Size