PTPRE antibody (Middle Region)
-
- Target See all PTPRE Antibodies
- PTPRE (Protein tyrosine Phosphatase, Receptor Type, E (PTPRE))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTPRE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PTPRE antibody was raised against the middle region of PTPRE
- Purification
- Affinity purified
- Immunogen
- PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW
- Top Product
- Discover our top product PTPRE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTPRE Blocking Peptide, catalog no. 33R-9603, is also available for use as a blocking control in assays to test for specificity of this PTPRE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTPRE (Protein tyrosine Phosphatase, Receptor Type, E (PTPRE))
- Alternative Name
- PTPRE (PTPRE Products)
- Synonyms
- ptpra antibody, HPTPE antibody, PTPE antibody, R-PTP-EPSILON antibody, PTPe antibody, PTPepsilon antibody, RPTPepsilon antibody, protein tyrosine phosphatase, receptor type E L homeolog antibody, protein tyrosine phosphatase, receptor type E antibody, protein tyrosine phosphatase, receptor type, E antibody, ptpre.L antibody, PTPRE antibody, Ptpre antibody
- Background
- PTPRE is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains.
- Molecular Weight
- 81 kDa (MW of target protein)
-