SPINT2 antibody (Middle Region)
-
- Target See all SPINT2 Antibodies
- SPINT2 (serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPINT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SPINT2 antibody was raised against the middle region of SPINT2
- Purification
- Affinity purified
- Immunogen
- SPINT2 antibody was raised using the middle region of SPINT2 corresponding to a region with amino acids MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE
- Top Product
- Discover our top product SPINT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPINT2 Blocking Peptide, catalog no. 33R-6208, is also available for use as a blocking control in assays to test for specificity of this SPINT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPINT2 (serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2))
- Alternative Name
- SPINT2 (SPINT2 Products)
- Synonyms
- HAI-2 antibody, Pb antibody, DIAR3 antibody, HAI2 antibody, Kop antibody, PB antibody, AL024025 antibody, C76321 antibody, serine peptidase inhibitor, Kunitz type, 2 antibody, serine peptidase inhibitor, Kunitz type 2 antibody, serine protease inhibitor, Kunitz type 2 antibody, Spint2 antibody, SPINT2 antibody
- Background
- HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the kDa-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.
- Molecular Weight
- 28 kDa (MW of target protein)
-