ZMPSTE24 antibody
-
- Target See all ZMPSTE24 (Zmpste24) Antibodies
- ZMPSTE24 (Zmpste24) (Zinc Metalloproteinase, Ste24 (Zmpste24))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZMPSTE24 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ZMPSTE24 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL
- Top Product
- Discover our top product Zmpste24 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZMPSTE24 Blocking Peptide, catalog no. 33R-5572, is also available for use as a blocking control in assays to test for specificity of this ZMPSTE24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZMPSTE24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZMPSTE24 (Zmpste24) (Zinc Metalloproteinase, Ste24 (Zmpste24))
- Alternative Name
- ZMPSTE24 (Zmpste24 Products)
- Synonyms
- DDBDRAFT_0189115 antibody, DDBDRAFT_0237846 antibody, DDB_0189115 antibody, DDB_0237846 antibody, F2N1.21 antibody, F2N1_21 antibody, STE24 antibody, FACE-1 antibody, FACE1 antibody, HGPS antibody, PRO1 antibody, Ste24p antibody, A530043O15Rik antibody, D030046F19 antibody, Face-1 antibody, MADB antibody, fi45a02 antibody, wu:fi45a02 antibody, zgc:55655 antibody, zinc metallopeptidase STE24 antibody, zinc metallopeptidase STE24 L homeolog antibody, CAAX prenyl protease antibody, Peptidase family M48 family protein antibody, zinc metallopeptidase, STE24 antibody, zinc metallopeptidase, STE24 homolog antibody, ZMPSTE24 antibody, zmpste24.L antibody, zmpste24 antibody, ATSTE24 antibody, Zmpste24 antibody
- Background
- ZMPSTE24 is a member of the peptidase M48A family. This protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in ZMPSTE24 gene have been associated with mandibuloacral dysplasia and restrictive dermopathy.
- Molecular Weight
- 55 kDa (MW of target protein)
-