NOX1 antibody (C-Term)
-
- Target See all NOX1 Antibodies
- NOX1 (NADPH Oxidase 1 (NOX1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NOX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NOX1 antibody was raised against the C terminal of NOX1
- Purification
- Affinity purified
- Immunogen
- NOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
- Top Product
- Discover our top product NOX1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NOX1 Blocking Peptide, catalog no. 33R-8868, is also available for use as a blocking control in assays to test for specificity of this NOX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOX1 (NADPH Oxidase 1 (NOX1))
- Alternative Name
- NOX1 (NOX1 Products)
- Synonyms
- GP91-2 antibody, MOX1 antibody, NOH-1 antibody, NOH1 antibody, NOX1a antibody, NOX1alpha antibody, Nox-1 antibody, Nox1 antibody, NADPH oxidase 1 antibody, NOX1 antibody, Nox1 antibody, nox1 antibody
- Background
- Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Regulation of Systemic Arterial Blood Pressure by Hormones, Proton Transport
-