WNT4 antibody (Middle Region)

Catalog No. ABIN636044

Product Details anti-WNT4 Antibody

Target: WNT4 (Wingless-Type MMTV Integration Site Family, Member 4 (WNT4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WNT4 antibody was raised against the middle region of WNT4

Purification: Affinity purified

Immunogen: WNT4 antibody was raised using the middle region of WNT4 corresponding to a region with amino acids HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT4 Blocking Peptide, catalog no. 33R-3744, is also available for use as a blocking control in assays to test for specificity of this WNT4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT4

Target: WNT4 (Wingless-Type MMTV Integration Site Family, Member 4 (WNT4))

Alternative Name: WNT4 (WNT4 Products)

Synonyms: CG4698 antibody, DWnt-4 antibody, DWnt4 antibody, Dm DWnt4 antibody, Dmel\\CG4698 antibody, Dwnt4 antibody, Wnt antibody, Wnt-4 antibody, anon-EST:Liang-2.4 antibody, clone 2.4 antibody, wnt-4 antibody, wnt4 antibody, SERKAL antibody, WNT-4 antibody, Xwnt4 antibody, xwnt-4 antibody, zgc:136737 antibody, Wnt family member 4 antibody, Wnt oncogene analog 4 antibody, wingless-type MMTV integration site family, member 4 antibody, wingless-type MMTV integration site family member 4 S homeolog antibody, wingless-type MMTV integration site family, member 4a antibody, WNT4 antibody, Wnt4 antibody, wnt4.S antibody, wnt4a antibody

Background: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: WNT Signaling, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Cell-Cell Junction Organization, Tube Formation