WNT4 antibody (Middle Region)
-
- Target See all WNT4 Antibodies
- WNT4 (Wingless-Type MMTV Integration Site Family, Member 4 (WNT4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WNT4 antibody was raised against the middle region of WNT4
- Purification
- Affinity purified
- Immunogen
- WNT4 antibody was raised using the middle region of WNT4 corresponding to a region with amino acids HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE
- Top Product
- Discover our top product WNT4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WNT4 Blocking Peptide, catalog no. 33R-3744, is also available for use as a blocking control in assays to test for specificity of this WNT4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT4 (Wingless-Type MMTV Integration Site Family, Member 4 (WNT4))
- Alternative Name
- WNT4 (WNT4 Products)
- Synonyms
- CG4698 antibody, DWnt-4 antibody, DWnt4 antibody, Dm DWnt4 antibody, Dmel\\CG4698 antibody, Dwnt4 antibody, Wnt antibody, Wnt-4 antibody, anon-EST:Liang-2.4 antibody, clone 2.4 antibody, wnt-4 antibody, wnt4 antibody, SERKAL antibody, WNT-4 antibody, Xwnt4 antibody, xwnt-4 antibody, zgc:136737 antibody, Wnt family member 4 antibody, Wnt oncogene analog 4 antibody, wingless-type MMTV integration site family, member 4 antibody, wingless-type MMTV integration site family member 4 S homeolog antibody, wingless-type MMTV integration site family, member 4a antibody, WNT4 antibody, Wnt4 antibody, wnt4.S antibody, wnt4a antibody
- Background
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- WNT Signaling, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Cell-Cell Junction Organization, Tube Formation
-