FZD4 antibody

Catalog No. ABIN636047

Product Details anti-FZD4 Antibody

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZD4 Blocking Peptide, catalog no. 33R-3346, is also available for use as a blocking control in assays to test for specificity of this FZD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZD4

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Alternative Name: FZD4 (FZD4 Products)

Synonyms: CG4626 antibody, DFz4 antibody, Dfz4 antibody, Dm Fz4 antibody, Dmel\\CG4626 antibody, Fz4 antibody, anon-WO0170980.10 antibody, anon-WO0170980.11 antibody, fz1 antibody, zg01 antibody, CD344 antibody, EVR1 antibody, FEVR antibody, FZD4S antibody, Fz-4 antibody, FzE4 antibody, GPCR antibody, hFz4 antibody, frizzled4 antibody, fz4 antibody, FZ-4 antibody, frizzled 4 antibody, frizzled class receptor 4 antibody, frizzled-4 antibody, frizzled class receptor 4 S homeolog antibody, fz4 antibody, fzd4 antibody, Tsp_10376 antibody, FZD4 antibody, Fzd4 antibody, fzd4.S antibody

Background: FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: WNT Signaling, Hormone Transport, Sensory Perception of Sound